Protein Description: origin recognition complex subunit 1
Gene Name: ORC1
Alternative Gene Name: HSORC1, ORC1L, PARC1
Sequence: LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA
Interspecies mouse/rat: ENSMUSG00000028587: 96%, ENSRNOG00000008841: 96%
Entrez Gene ID: 4998
Uniprot ID: Q13415
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ORC1
Alternative Gene Name: HSORC1, ORC1L, PARC1
Sequence: LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA
Interspecies mouse/rat: ENSMUSG00000028587: 96%, ENSRNOG00000008841: 96%
Entrez Gene ID: 4998
Uniprot ID: Q13415
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | LEEATFQQIYSQHVALCRMEGLPYPTMSETMAVCSHLGSCRLLLVEPSRNDLLLRVRLNVSQDDVLYA |
Gene ID - Mouse | ENSMUSG00000028587 |
Gene ID - Rat | ENSRNOG00000008841 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen ORC1 (ATL-APrEST94588) | |
Datasheet | PrEST Antigen ORC1 (ATL-APrEST94588) Datasheet (External Link) |
Vendor Page | PrEST Antigen ORC1 (ATL-APrEST94588) at Atlas |
Documents & Links for PrEST Antigen ORC1 (ATL-APrEST94588) | |
Datasheet | PrEST Antigen ORC1 (ATL-APrEST94588) Datasheet (External Link) |
Vendor Page | PrEST Antigen ORC1 (ATL-APrEST94588) |