Protein Description: olfactory receptor, family 8, subfamily S, member 1
Gene Name: OR8S1
Alternative Gene Name:
Sequence: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Interspecies mouse/rat: ENSMUSG00000031790: 36%, ENSRNOG00000051980: 36%
Entrez Gene ID: 341568
Uniprot ID: Q8NH09
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: OR8S1
Alternative Gene Name:
Sequence: ERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQP
Interspecies mouse/rat: ENSMUSG00000031790: 36%, ENSRNOG00000051980: 36%
Entrez Gene ID: 341568
Uniprot ID: Q8NH09
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen OR8S1 (ATL-APrEST84647) | |
Antibody | Anti OR8S1 pAb (ATL-HPA045595) |
Documents & Links for PrEST Antigen OR8S1 (ATL-APrEST84647) | |
Datasheet | PrEST Antigen OR8S1 (ATL-APrEST84647) Datasheet (External Link) |
Vendor Page | PrEST Antigen OR8S1 (ATL-APrEST84647) at Atlas |
Documents & Links for PrEST Antigen OR8S1 (ATL-APrEST84647) | |
Datasheet | PrEST Antigen OR8S1 (ATL-APrEST84647) Datasheet (External Link) |
Vendor Page | PrEST Antigen OR8S1 (ATL-APrEST84647) |