Protein Description: nicotinamide nucleotide adenylyltransferase 1
Gene Name: NMNAT1
Alternative Gene Name: NMNAT, PNAT1
Sequence: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: NMNAT1
Alternative Gene Name: NMNAT, PNAT1
Sequence: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Interspecies mouse/rat: ENSMUSG00000028992: 72%, ENSRNOG00000015962: 75%
Entrez Gene ID: 64802
Uniprot ID: Q9HAN9
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen NMNAT1 (ATL-APrEST86322) | |
| Antibody | Anti NMNAT1 pAb (ATL-HPA059447) |
| Documents & Links for PrEST Antigen NMNAT1 (ATL-APrEST86322) | |
| Datasheet | PrEST Antigen NMNAT1 (ATL-APrEST86322) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT1 (ATL-APrEST86322) at Atlas |
| Documents & Links for PrEST Antigen NMNAT1 (ATL-APrEST86322) | |
| Datasheet | PrEST Antigen NMNAT1 (ATL-APrEST86322) Datasheet (External Link) |
| Vendor Page | PrEST Antigen NMNAT1 (ATL-APrEST86322) |