PrEST Antigen NFAT5, Gene description: nuclear factor of activated T cells 5, Alternative Gene Names: KIAA0827, NF-AT5, NFATL1, NFATZ, OREBP, TONEBP, Antigen sequence: TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications |
| Gene Sequence |
TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH |
| Gene ID - Mouse |
ENSMUSG00000003847 |
| Gene ID - Rat |
ENSMUSG00000003847 |
| Buffer |
PBS and 1M Urea, pH 7.4. |
