PrEST Antigen NCAM1 (ATL-APrEST87341)
Atlas Antibodies
- SKU:
- ATL-APrEST87341-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: NCAM1
Alternative Gene Name: CD56, NCAM
Sequence: DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK
Interspecies mouse/rat: ENSMUSG00000039542: 93%, ENSRNOG00000031890: 94%
Entrez Gene ID: 4684
Uniprot ID: P13591
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | DSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEEVWHSKWYDAK |
Gene ID - Mouse | ENSMUSG00000039542 |
Gene ID - Rat | ENSRNOG00000031890 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen NCAM1 (ATL-APrEST87341) | |
Datasheet | PrEST Antigen NCAM1 (ATL-APrEST87341) Datasheet (External Link) |
Vendor Page | PrEST Antigen NCAM1 (ATL-APrEST87341) at Atlas Antibodies |
Documents & Links for PrEST Antigen NCAM1 (ATL-APrEST87341) | |
Datasheet | PrEST Antigen NCAM1 (ATL-APrEST87341) Datasheet (External Link) |
Vendor Page | PrEST Antigen NCAM1 (ATL-APrEST87341) |