Protein Description: mitochondrial ribosomal protein S36
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
Interspecies mouse/rat: ENSMUSG00000061474: 78%, ENSRNOG00000061213: 78%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
Interspecies mouse/rat: ENSMUSG00000061474: 78%, ENSRNOG00000061213: 78%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen MRPS36 (ATL-APrEST91759) | |
| Antibody | Anti MRPS36 pAb (ATL-HPA056795) |
| Documents & Links for PrEST Antigen MRPS36 (ATL-APrEST91759) | |
| Datasheet | PrEST Antigen MRPS36 (ATL-APrEST91759) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MRPS36 (ATL-APrEST91759) at Atlas |
| Documents & Links for PrEST Antigen MRPS36 (ATL-APrEST91759) | |
| Datasheet | PrEST Antigen MRPS36 (ATL-APrEST91759) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MRPS36 (ATL-APrEST91759) |