PrEST Antigen MPO (ATL-APrEST87920)
Atlas Antibodies
- SKU:
- ATL-APrEST87920-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: MPO
Alternative Gene Name:
Sequence: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
Interspecies mouse/rat: ENSMUSG00000009350: 76%, ENSRNOG00000008310: 74%
Entrez Gene ID: 4353
Uniprot ID: P05164
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR |
| Gene ID - Mouse | ENSMUSG00000009350 |
| Gene ID - Rat | ENSRNOG00000008310 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen MPO (ATL-APrEST87920) | |
| Datasheet | PrEST Antigen MPO (ATL-APrEST87920) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MPO (ATL-APrEST87920) at Atlas Antibodies |
| Documents & Links for PrEST Antigen MPO (ATL-APrEST87920) | |
| Datasheet | PrEST Antigen MPO (ATL-APrEST87920) Datasheet (External Link) |
| Vendor Page | PrEST Antigen MPO (ATL-APrEST87920) |