Protein Description: LLP homolog, long-term synaptic facilitation (Aplysia)
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Sequence: RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK
Interspecies mouse/rat: ENSMUSG00000020224: 82%, ENSRNOG00000004316: 84%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Sequence: RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK
Interspecies mouse/rat: ENSMUSG00000020224: 82%, ENSRNOG00000004316: 84%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen LLPH (ATL-APrEST89863) | |
Antibody | Anti LLPH pAb (ATL-HPA058786) |
Documents & Links for PrEST Antigen LLPH (ATL-APrEST89863) | |
Datasheet | PrEST Antigen LLPH (ATL-APrEST89863) Datasheet (External Link) |
Vendor Page | PrEST Antigen LLPH (ATL-APrEST89863) at Atlas |
Documents & Links for PrEST Antigen LLPH (ATL-APrEST89863) | |
Datasheet | PrEST Antigen LLPH (ATL-APrEST89863) Datasheet (External Link) |
Vendor Page | PrEST Antigen LLPH (ATL-APrEST89863) |