Protein Description: lin-7 homolog A, crumbs cell polarity complex component
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Sequence: EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Sequence: EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV |
Gene ID - Mouse | ENSMUSG00000019906 |
Gene ID - Rat | ENSRNOG00000004527 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen LIN7A (ATL-APrEST94354) | |
Datasheet | PrEST Antigen LIN7A (ATL-APrEST94354) Datasheet (External Link) |
Vendor Page | PrEST Antigen LIN7A (ATL-APrEST94354) at Atlas |
Documents & Links for PrEST Antigen LIN7A (ATL-APrEST94354) | |
Datasheet | PrEST Antigen LIN7A (ATL-APrEST94354) Datasheet (External Link) |
Vendor Page | PrEST Antigen LIN7A (ATL-APrEST94354) |