Protein Description: leukocyte cell derived chemotaxin 2
Gene Name: LECT2
Alternative Gene Name: chm-II, chm2
Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
Interspecies mouse/rat: ENSMUSG00000021539: 83%, ENSRNOG00000012189: 80%
Entrez Gene ID: 3950
Uniprot ID: O14960
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: LECT2
Alternative Gene Name: chm-II, chm2
Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
Interspecies mouse/rat: ENSMUSG00000021539: 83%, ENSRNOG00000012189: 80%
Entrez Gene ID: 3950
Uniprot ID: O14960
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ |
Gene ID - Mouse | ENSMUSG00000021539 |
Gene ID - Rat | ENSRNOG00000012189 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen LECT2 (ATL-APrEST94780) | |
Datasheet | PrEST Antigen LECT2 (ATL-APrEST94780) Datasheet (External Link) |
Vendor Page | PrEST Antigen LECT2 (ATL-APrEST94780) at Atlas |
Documents & Links for PrEST Antigen LECT2 (ATL-APrEST94780) | |
Datasheet | PrEST Antigen LECT2 (ATL-APrEST94780) Datasheet (External Link) |
Vendor Page | PrEST Antigen LECT2 (ATL-APrEST94780) |