PrEST Antigen KPNA4 (ATL-APrEST87456)
Atlas Antibodies
- SKU:
- ATL-APrEST87456-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: KPNA4
Alternative Gene Name: IPOA3, MGC12217, MGC26703, QIP1, SRP3
Sequence: KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ
Interspecies mouse/rat: ENSMUSG00000027782: 97%, ENSRNOG00000010768: 97%
Entrez Gene ID: 3840
Uniprot ID: O00629
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | KRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQ |
Gene ID - Mouse | ENSMUSG00000027782 |
Gene ID - Rat | ENSRNOG00000010768 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen KPNA4 (ATL-APrEST87456) | |
Datasheet | PrEST Antigen KPNA4 (ATL-APrEST87456) Datasheet (External Link) |
Vendor Page | PrEST Antigen KPNA4 (ATL-APrEST87456) at Atlas Antibodies |
Documents & Links for PrEST Antigen KPNA4 (ATL-APrEST87456) | |
Datasheet | PrEST Antigen KPNA4 (ATL-APrEST87456) Datasheet (External Link) |
Vendor Page | PrEST Antigen KPNA4 (ATL-APrEST87456) |