Protein Description: inositol hexakisphosphate kinase 3
Gene Name: IP6K3
Alternative Gene Name: IHPK3, INSP6K3
Sequence: LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID
Interspecies mouse/rat: ENSMUSG00000024210: 42%, ENSRNOG00000025883: 49%
Entrez Gene ID: 117283
Uniprot ID: Q96PC2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: IP6K3
Alternative Gene Name: IHPK3, INSP6K3
Sequence: LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID
Interspecies mouse/rat: ENSMUSG00000024210: 42%, ENSRNOG00000025883: 49%
Entrez Gene ID: 117283
Uniprot ID: Q96PC2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | LVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMID |
| Gene ID - Mouse | ENSMUSG00000024210 |
| Gene ID - Rat | ENSRNOG00000025883 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen IP6K3 (ATL-APrEST94848) | |
| Datasheet | PrEST Antigen IP6K3 (ATL-APrEST94848) Datasheet (External Link) |
| Vendor Page | PrEST Antigen IP6K3 (ATL-APrEST94848) at Atlas |
| Documents & Links for PrEST Antigen IP6K3 (ATL-APrEST94848) | |
| Datasheet | PrEST Antigen IP6K3 (ATL-APrEST94848) Datasheet (External Link) |
| Vendor Page | PrEST Antigen IP6K3 (ATL-APrEST94848) |