PrEST Antigen INMT (ATL-APrEST92135)
Atlas Antibodies
- SKU:
- ATL-APrEST92135-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: INMT
Alternative Gene Name:
Sequence: RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL
Interspecies mouse/rat: ENSMUSG00000003477: 67%, ENSRNOG00000011250: 67%
Entrez Gene ID: 11185
Uniprot ID: O95050
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL |
Gene ID - Mouse | ENSMUSG00000003477 |
Gene ID - Rat | ENSRNOG00000011250 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen INMT (ATL-APrEST92135) | |
Datasheet | PrEST Antigen INMT (ATL-APrEST92135) Datasheet (External Link) |
Vendor Page | PrEST Antigen INMT (ATL-APrEST92135) at Atlas Antibodies |
Documents & Links for PrEST Antigen INMT (ATL-APrEST92135) | |
Datasheet | PrEST Antigen INMT (ATL-APrEST92135) Datasheet (External Link) |
Vendor Page | PrEST Antigen INMT (ATL-APrEST92135) |