Protein Description: general transcription factor IIH, polypeptide 4, 52kDa
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GTF2H4
Alternative Gene Name: P52, TFB2, TFIIH
Sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Interspecies mouse/rat: ENSMUSG00000001524: 99%, ENSRNOG00000000831: 99%
Entrez Gene ID: 2968
Uniprot ID: Q92759
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GTF2H4 (ATL-APrEST93213) | |
| Antibody | Anti GTF2H4 pAb (ATL-HPA074336) |
| Documents & Links for PrEST Antigen GTF2H4 (ATL-APrEST93213) | |
| Datasheet | PrEST Antigen GTF2H4 (ATL-APrEST93213) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GTF2H4 (ATL-APrEST93213) at Atlas |
| Documents & Links for PrEST Antigen GTF2H4 (ATL-APrEST93213) | |
| Datasheet | PrEST Antigen GTF2H4 (ATL-APrEST93213) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GTF2H4 (ATL-APrEST93213) |