Protein Description: general transcription factor IIH, polypeptide 2, 44kDa
Gene Name: GTF2H2
Alternative Gene Name: BTF2, BTF2P44, p44, T-BTF2P44, TFIIH
Sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Interspecies mouse/rat: ENSMUSG00000021639: 97%, ENSRNOG00000018230: 96%
Entrez Gene ID: 2966
Uniprot ID: Q13888
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GTF2H2
Alternative Gene Name: BTF2, BTF2P44, p44, T-BTF2P44, TFIIH
Sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG
Interspecies mouse/rat: ENSMUSG00000021639: 97%, ENSRNOG00000018230: 96%
Entrez Gene ID: 2966
Uniprot ID: Q13888
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GTF2H2 (ATL-APrEST89535) | |
| Antibody | Anti GTF2H2 pAb (ATL-HPA047001) |
| Documents & Links for PrEST Antigen GTF2H2 (ATL-APrEST89535) | |
| Datasheet | PrEST Antigen GTF2H2 (ATL-APrEST89535) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GTF2H2 (ATL-APrEST89535) at Atlas |
| Documents & Links for PrEST Antigen GTF2H2 (ATL-APrEST89535) | |
| Datasheet | PrEST Antigen GTF2H2 (ATL-APrEST89535) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GTF2H2 (ATL-APrEST89535) |