Protein Description: glutamic-oxaloacetic transaminase 1, soluble
Gene Name: GOT1
Alternative Gene Name: AST1
Sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Interspecies mouse/rat: ENSMUSG00000025190: 96%, ENSRNOG00000016356: 91%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GOT1
Alternative Gene Name: AST1
Sequence: IGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Interspecies mouse/rat: ENSMUSG00000025190: 96%, ENSRNOG00000016356: 91%
Entrez Gene ID: 2805
Uniprot ID: P17174
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GOT1 (ATL-APrEST90385) | |
| Antibody | Anti GOT1 pAb (ATL-HPA072629 w/enhanced validation) |
| Documents & Links for PrEST Antigen GOT1 (ATL-APrEST90385) | |
| Datasheet | PrEST Antigen GOT1 (ATL-APrEST90385) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GOT1 (ATL-APrEST90385) at Atlas |
| Documents & Links for PrEST Antigen GOT1 (ATL-APrEST90385) | |
| Datasheet | PrEST Antigen GOT1 (ATL-APrEST90385) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GOT1 (ATL-APrEST90385) |