Protein Description: GLIS family zinc finger 2
Gene Name: GLIS2
Alternative Gene Name: NPHP7
Sequence: VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS
Interspecies mouse/rat: ENSMUSG00000014303: 92%, ENSRNOG00000004766: 92%
Entrez Gene ID: 84662
Uniprot ID: Q9BZE0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GLIS2
Alternative Gene Name: NPHP7
Sequence: VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS
Interspecies mouse/rat: ENSMUSG00000014303: 92%, ENSRNOG00000004766: 92%
Entrez Gene ID: 84662
Uniprot ID: Q9BZE0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | VEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSS |
| Gene ID - Mouse | ENSMUSG00000014303 |
| Gene ID - Rat | ENSRNOG00000004766 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen GLIS2 (ATL-APrEST94851) | |
| Datasheet | PrEST Antigen GLIS2 (ATL-APrEST94851) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GLIS2 (ATL-APrEST94851) at Atlas |
| Documents & Links for PrEST Antigen GLIS2 (ATL-APrEST94851) | |
| Datasheet | PrEST Antigen GLIS2 (ATL-APrEST94851) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GLIS2 (ATL-APrEST94851) |