Protein Description: glycine cleavage system protein H
Gene Name: GCSH
Alternative Gene Name:
Sequence: VNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Interspecies mouse/rat: ENSMUSG00000034424: 93%, ENSRNOG00000011535: 95%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GCSH
Alternative Gene Name:
Sequence: VNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
Interspecies mouse/rat: ENSMUSG00000034424: 93%, ENSRNOG00000011535: 95%
Entrez Gene ID: 2653
Uniprot ID: P23434
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen GCSH (ATL-APrEST94760) | |
Antibody | Anti GCSH pAb (ATL-HPA057079) |
Documents & Links for PrEST Antigen GCSH (ATL-APrEST94760) | |
Datasheet | PrEST Antigen GCSH (ATL-APrEST94760) Datasheet (External Link) |
Vendor Page | PrEST Antigen GCSH (ATL-APrEST94760) at Atlas |
Documents & Links for PrEST Antigen GCSH (ATL-APrEST94760) | |
Datasheet | PrEST Antigen GCSH (ATL-APrEST94760) Datasheet (External Link) |
Vendor Page | PrEST Antigen GCSH (ATL-APrEST94760) |