Protein Description: gastrulation brain homeobox 2
Gene Name: GBX2
Alternative Gene Name:
Sequence: AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET
Interspecies mouse/rat: ENSMUSG00000034486: 96%, ENSRNOG00000019495: 96%
Entrez Gene ID: 2637
Uniprot ID: P52951
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GBX2
Alternative Gene Name:
Sequence: AVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEET
Interspecies mouse/rat: ENSMUSG00000034486: 96%, ENSRNOG00000019495: 96%
Entrez Gene ID: 2637
Uniprot ID: P52951
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen GBX2 (ATL-APrEST90228) | |
| Antibody | Anti GBX2 pAb (ATL-HPA067809) |
| Documents & Links for PrEST Antigen GBX2 (ATL-APrEST90228) | |
| Datasheet | PrEST Antigen GBX2 (ATL-APrEST90228) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GBX2 (ATL-APrEST90228) at Atlas |
| Documents & Links for PrEST Antigen GBX2 (ATL-APrEST90228) | |
| Datasheet | PrEST Antigen GBX2 (ATL-APrEST90228) Datasheet (External Link) |
| Vendor Page | PrEST Antigen GBX2 (ATL-APrEST90228) |