Protein Description: gamma-aminobutyric acid (GABA) A receptor, beta 1
Gene Name: GABRB1
Alternative Gene Name:
Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Interspecies mouse/rat: ENSMUSG00000029212: 97%, ENSRNOG00000002327: 100%
Entrez Gene ID: 2560
Uniprot ID: P18505
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: GABRB1
Alternative Gene Name:
Sequence: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI
Interspecies mouse/rat: ENSMUSG00000029212: 97%, ENSRNOG00000002327: 100%
Entrez Gene ID: 2560
Uniprot ID: P18505
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen GABRB1 (ATL-APrEST85642) | |
Antibody | Anti GABRB1 pAb (ATL-HPA051297) |
Documents & Links for PrEST Antigen GABRB1 (ATL-APrEST85642) | |
Datasheet | PrEST Antigen GABRB1 (ATL-APrEST85642) Datasheet (External Link) |
Vendor Page | PrEST Antigen GABRB1 (ATL-APrEST85642) at Atlas |
Documents & Links for PrEST Antigen GABRB1 (ATL-APrEST85642) | |
Datasheet | PrEST Antigen GABRB1 (ATL-APrEST85642) Datasheet (External Link) |
Vendor Page | PrEST Antigen GABRB1 (ATL-APrEST85642) |