Protein Description: fatty acid 2-hydroxylase
Gene Name: FA2H
Alternative Gene Name: FAAH, FAXDC1, FLJ25287, SPG35
Sequence: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
Interspecies mouse/rat: ENSMUSG00000033579: 92%, ENSRNOG00000018950: 95%
Entrez Gene ID: 79152
Uniprot ID: Q7L5A8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: FA2H
Alternative Gene Name: FAAH, FAXDC1, FLJ25287, SPG35
Sequence: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
Interspecies mouse/rat: ENSMUSG00000033579: 92%, ENSRNOG00000018950: 95%
Entrez Gene ID: 79152
Uniprot ID: Q7L5A8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen FA2H (ATL-APrEST87765) | |
| Antibody | Anti FA2H pAb (ATL-HPA056614) |
| Documents & Links for PrEST Antigen FA2H (ATL-APrEST87765) | |
| Datasheet | PrEST Antigen FA2H (ATL-APrEST87765) Datasheet (External Link) |
| Vendor Page | PrEST Antigen FA2H (ATL-APrEST87765) at Atlas |
| Documents & Links for PrEST Antigen FA2H (ATL-APrEST87765) | |
| Datasheet | PrEST Antigen FA2H (ATL-APrEST87765) Datasheet (External Link) |
| Vendor Page | PrEST Antigen FA2H (ATL-APrEST87765) |