Protein Description: enhancer of zeste 1 polycomb repressive complex 2 subunit
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Sequence: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: EZH1
Alternative Gene Name: KIAA0388, KMT6B
Sequence: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
Interspecies mouse/rat: ENSMUSG00000006920: 96%, ENSRNOG00000020336: 92%
Entrez Gene ID: 2145
Uniprot ID: Q92800
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen EZH1 (ATL-APrEST94472) | |
| Antibody | Anti EZH1 pAb (ATL-HPA077684) |
| Documents & Links for PrEST Antigen EZH1 (ATL-APrEST94472) | |
| Datasheet | PrEST Antigen EZH1 (ATL-APrEST94472) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EZH1 (ATL-APrEST94472) at Atlas |
| Documents & Links for PrEST Antigen EZH1 (ATL-APrEST94472) | |
| Datasheet | PrEST Antigen EZH1 (ATL-APrEST94472) Datasheet (External Link) |
| Vendor Page | PrEST Antigen EZH1 (ATL-APrEST94472) |