Protein Description: ephrin A2
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Sequence: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: EFNA2
Alternative Gene Name: ELF-1, EPLG6, LERK6
Sequence: PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG
Interspecies mouse/rat: ENSMUSG00000003070: 88%, ENSRNOG00000016203: 88%
Entrez Gene ID: 1943
Uniprot ID: O43921
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG |
Gene ID - Mouse | ENSMUSG00000003070 |
Gene ID - Rat | ENSRNOG00000016203 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen EFNA2 (ATL-APrEST94296) | |
Datasheet | PrEST Antigen EFNA2 (ATL-APrEST94296) Datasheet (External Link) |
Vendor Page | PrEST Antigen EFNA2 (ATL-APrEST94296) at Atlas |
Documents & Links for PrEST Antigen EFNA2 (ATL-APrEST94296) | |
Datasheet | PrEST Antigen EFNA2 (ATL-APrEST94296) Datasheet (External Link) |
Vendor Page | PrEST Antigen EFNA2 (ATL-APrEST94296) |