Protein Description: DS cell adhesion molecule
Gene Name: DSCAM
Alternative Gene Name: CHD2-42, CHD2-52
Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
Interspecies mouse/rat: ENSMUSG00000050272: 97%, ENSRNOG00000027992: 97%
Entrez Gene ID: 1826
Uniprot ID: O60469
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DSCAM
Alternative Gene Name: CHD2-42, CHD2-52
Sequence: QDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLK
Interspecies mouse/rat: ENSMUSG00000050272: 97%, ENSRNOG00000027992: 97%
Entrez Gene ID: 1826
Uniprot ID: O60469
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen DSCAM (ATL-APrEST94765) | |
Antibody | Anti DSCAM pAb (ATL-HPA057493) |
Documents & Links for PrEST Antigen DSCAM (ATL-APrEST94765) | |
Datasheet | PrEST Antigen DSCAM (ATL-APrEST94765) Datasheet (External Link) |
Vendor Page | PrEST Antigen DSCAM (ATL-APrEST94765) at Atlas |
Documents & Links for PrEST Antigen DSCAM (ATL-APrEST94765) | |
Datasheet | PrEST Antigen DSCAM (ATL-APrEST94765) Datasheet (External Link) |
Vendor Page | PrEST Antigen DSCAM (ATL-APrEST94765) |