Protein Description: dermatopontin
Gene Name: DPT
Alternative Gene Name:
Sequence: GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
Interspecies mouse/rat: ENSMUSG00000026574: 91%, ENSRNOG00000002947: 94%
Entrez Gene ID: 1805
Uniprot ID: Q07507
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DPT
Alternative Gene Name:
Sequence: GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
Interspecies mouse/rat: ENSMUSG00000026574: 91%, ENSRNOG00000002947: 94%
Entrez Gene ID: 1805
Uniprot ID: Q07507
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen DPT (ATL-APrEST92578) | |
| Antibody | Anti DPT pAb (ATL-HPA065548) |
| Documents & Links for PrEST Antigen DPT (ATL-APrEST92578) | |
| Datasheet | PrEST Antigen DPT (ATL-APrEST92578) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DPT (ATL-APrEST92578) at Atlas |
| Documents & Links for PrEST Antigen DPT (ATL-APrEST92578) | |
| Datasheet | PrEST Antigen DPT (ATL-APrEST92578) Datasheet (External Link) |
| Vendor Page | PrEST Antigen DPT (ATL-APrEST92578) |