Protein Description: DnaJ heat shock protein family (Hsp40) member C5 beta
Gene Name: DNAJC5B
Alternative Gene Name: CSP-beta, MGC26226
Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Interspecies mouse/rat: ENSMUSG00000027606: 90%, ENSRNOG00000012851: 88%
Entrez Gene ID: 85479
Uniprot ID: Q9UF47
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DNAJC5B
Alternative Gene Name: CSP-beta, MGC26226
Sequence: MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR
Interspecies mouse/rat: ENSMUSG00000027606: 90%, ENSRNOG00000012851: 88%
Entrez Gene ID: 85479
Uniprot ID: Q9UF47
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR |
Gene ID - Mouse | ENSMUSG00000027606 |
Gene ID - Rat | ENSRNOG00000012851 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen DNAJC5B (ATL-APrEST94460) | |
Datasheet | PrEST Antigen DNAJC5B (ATL-APrEST94460) Datasheet (External Link) |
Vendor Page | PrEST Antigen DNAJC5B (ATL-APrEST94460) at Atlas |
Documents & Links for PrEST Antigen DNAJC5B (ATL-APrEST94460) | |
Datasheet | PrEST Antigen DNAJC5B (ATL-APrEST94460) Datasheet (External Link) |
Vendor Page | PrEST Antigen DNAJC5B (ATL-APrEST94460) |