Protein Description: DnaJ heat shock protein family (Hsp40) member B12
Gene Name: DNAJB12
Alternative Gene Name: DJ10, FLJ20027
Sequence: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
Interspecies mouse/rat: ENSMUSG00000020109: 93%, ENSRNOG00000030408: 93%
Entrez Gene ID: 54788
Uniprot ID: Q9NXW2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DNAJB12
Alternative Gene Name: DJ10, FLJ20027
Sequence: PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW
Interspecies mouse/rat: ENSMUSG00000020109: 93%, ENSRNOG00000030408: 93%
Entrez Gene ID: 54788
Uniprot ID: Q9NXW2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLRNNCW |
Gene ID - Mouse | ENSMUSG00000020109 |
Gene ID - Rat | ENSRNOG00000030408 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen DNAJB12 (ATL-APrEST95131) | |
Datasheet | PrEST Antigen DNAJB12 (ATL-APrEST95131) Datasheet (External Link) |
Vendor Page | PrEST Antigen DNAJB12 (ATL-APrEST95131) at Atlas |
Documents & Links for PrEST Antigen DNAJB12 (ATL-APrEST95131) | |
Datasheet | PrEST Antigen DNAJB12 (ATL-APrEST95131) Datasheet (External Link) |
Vendor Page | PrEST Antigen DNAJB12 (ATL-APrEST95131) |