Protein Description: dehydrogenase/reductase (SDR family) member 2
Gene Name: DHRS2
Alternative Gene Name: HEP27, SDR25C1
Sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Interspecies mouse/rat: ENSMUSG00000022209: 80%, ENSRNOG00000018177: 80%
Entrez Gene ID: 10202
Uniprot ID: Q13268
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: DHRS2
Alternative Gene Name: HEP27, SDR25C1
Sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
Interspecies mouse/rat: ENSMUSG00000022209: 80%, ENSRNOG00000018177: 80%
Entrez Gene ID: 10202
Uniprot ID: Q13268
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen DHRS2 (ATL-APrEST88757) | |
Antibody | Anti DHRS2 pAb (ATL-HPA053915) |
Antibody | Anti DHRS2 pAb (ATL-HPA069551 w/enhanced validation) |
Documents & Links for PrEST Antigen DHRS2 (ATL-APrEST88757) | |
Datasheet | PrEST Antigen DHRS2 (ATL-APrEST88757) Datasheet (External Link) |
Vendor Page | PrEST Antigen DHRS2 (ATL-APrEST88757) at Atlas |
Documents & Links for PrEST Antigen DHRS2 (ATL-APrEST88757) | |
Datasheet | PrEST Antigen DHRS2 (ATL-APrEST88757) Datasheet (External Link) |
Vendor Page | PrEST Antigen DHRS2 (ATL-APrEST88757) |