PrEST Antigen CT45A1 (ATL-APrEST89066)
Atlas Antibodies
- SKU:
- ATL-APrEST89066-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: CT45A1
Alternative Gene Name: CT45-1, CT45.1
Sequence: PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Interspecies mouse/rat: ENSMUSG00000022821: 37%, ENSRNOG00000002701: 37%
Entrez Gene ID: 541466
Uniprot ID: Q5HYN5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI |
Gene ID - Mouse | ENSMUSG00000022821 |
Gene ID - Rat | ENSRNOG00000002701 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen CT45A1 (ATL-APrEST89066) | |
Datasheet | PrEST Antigen CT45A1 (ATL-APrEST89066) Datasheet (External Link) |
Vendor Page | PrEST Antigen CT45A1 (ATL-APrEST89066) at Atlas Antibodies |
Documents & Links for PrEST Antigen CT45A1 (ATL-APrEST89066) | |
Datasheet | PrEST Antigen CT45A1 (ATL-APrEST89066) Datasheet (External Link) |
Vendor Page | PrEST Antigen CT45A1 (ATL-APrEST89066) |