Protein Description: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
Gene Name: CSTF1
Alternative Gene Name:
Sequence: AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS
Interspecies mouse/rat: ENSMUSG00000027498: 99%, ENSRNOG00000004775: 99%
Entrez Gene ID: 1477
Uniprot ID: Q05048
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CSTF1
Alternative Gene Name:
Sequence: AKLWEISTGRTLVRYTGAGLSGRQVHRTQAVFNHTEDYVLLPDERTISLCCWDSRTAERRNLLSLGHNNIVRCIVHSPTNPGFMTCSDDFRARFWYRRS
Interspecies mouse/rat: ENSMUSG00000027498: 99%, ENSRNOG00000004775: 99%
Entrez Gene ID: 1477
Uniprot ID: Q05048
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen CSTF1 (ATL-APrEST90121) | |
| Antibody | Anti CSTF1 pAb (ATL-HPA065000) |
| Documents & Links for PrEST Antigen CSTF1 (ATL-APrEST90121) | |
| Datasheet | PrEST Antigen CSTF1 (ATL-APrEST90121) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CSTF1 (ATL-APrEST90121) at Atlas |
| Documents & Links for PrEST Antigen CSTF1 (ATL-APrEST90121) | |
| Datasheet | PrEST Antigen CSTF1 (ATL-APrEST90121) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CSTF1 (ATL-APrEST90121) |