Protein Description: cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Sequence: LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
Interspecies mouse/rat: ENSMUSG00000028719: 100%, ENSRNOG00000007775: 100%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CMPK1
Alternative Gene Name: CMPK, UMP-CMPK
Sequence: LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN
Interspecies mouse/rat: ENSMUSG00000028719: 100%, ENSRNOG00000007775: 100%
Entrez Gene ID: 51727
Uniprot ID: P30085
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen CMPK1 (ATL-APrEST86154) | |
Antibody | Anti CMPK1 pAb (ATL-HPA058604) |
Documents & Links for PrEST Antigen CMPK1 (ATL-APrEST86154) | |
Datasheet | PrEST Antigen CMPK1 (ATL-APrEST86154) Datasheet (External Link) |
Vendor Page | PrEST Antigen CMPK1 (ATL-APrEST86154) at Atlas |
Documents & Links for PrEST Antigen CMPK1 (ATL-APrEST86154) | |
Datasheet | PrEST Antigen CMPK1 (ATL-APrEST86154) Datasheet (External Link) |
Vendor Page | PrEST Antigen CMPK1 (ATL-APrEST86154) |