Protein Description: CDC28 protein kinase regulatory subunit 2
Gene Name: CKS2
Alternative Gene Name:
Sequence: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CKS2
Alternative Gene Name:
Sequence: HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Interspecies mouse/rat: ENSMUSG00000062248: 99%, ENSRNOG00000014130: 99%
Entrez Gene ID: 1164
Uniprot ID: P33552
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen CKS2 (ATL-APrEST86247) | |
| Antibody | Anti CKS2 pAb (ATL-HPA003424) |
| Antibody | Anti CKS2 pAb (ATL-HPA030762) |
| Documents & Links for PrEST Antigen CKS2 (ATL-APrEST86247) | |
| Datasheet | PrEST Antigen CKS2 (ATL-APrEST86247) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CKS2 (ATL-APrEST86247) at Atlas |
| Documents & Links for PrEST Antigen CKS2 (ATL-APrEST86247) | |
| Datasheet | PrEST Antigen CKS2 (ATL-APrEST86247) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CKS2 (ATL-APrEST86247) |