Protein Description: Cdk5 and Abl enzyme substrate 2
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen CABLES2 (ATL-APrEST91360) | |
| Antibody | Anti CABLES2 pAb (ATL-HPA052138) |
| Antibody | Anti-CABLES2 pAb (ATL-HPA043597) |
| Documents & Links for PrEST Antigen CABLES2 (ATL-APrEST91360) | |
| Datasheet | PrEST Antigen CABLES2 (ATL-APrEST91360) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CABLES2 (ATL-APrEST91360) at Atlas |
| Documents & Links for PrEST Antigen CABLES2 (ATL-APrEST91360) | |
| Datasheet | PrEST Antigen CABLES2 (ATL-APrEST91360) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CABLES2 (ATL-APrEST91360) |