Protein Description: calcium binding protein 39 like
Gene Name: CAB39L
Alternative Gene Name: bA103J18.3, FLJ12577, MO2L
Sequence: IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA
Interspecies mouse/rat: ENSMUSG00000021981: 100%, ENSRNOG00000011603: 100%
Entrez Gene ID: 81617
Uniprot ID: Q9H9S4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: CAB39L
Alternative Gene Name: bA103J18.3, FLJ12577, MO2L
Sequence: IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA
Interspecies mouse/rat: ENSMUSG00000021981: 100%, ENSRNOG00000011603: 100%
Entrez Gene ID: 81617
Uniprot ID: Q9H9S4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Product Specifications | |
| Gene Sequence | IMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVA |
| Gene ID - Mouse | ENSMUSG00000021981 |
| Gene ID - Rat | ENSRNOG00000011603 |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Documents & Links for PrEST Antigen CAB39L (ATL-APrEST95407) | |
| Datasheet | PrEST Antigen CAB39L (ATL-APrEST95407) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CAB39L (ATL-APrEST95407) at Atlas |
| Documents & Links for PrEST Antigen CAB39L (ATL-APrEST95407) | |
| Datasheet | PrEST Antigen CAB39L (ATL-APrEST95407) Datasheet (External Link) |
| Vendor Page | PrEST Antigen CAB39L (ATL-APrEST95407) |