Protein Description: chromosome 16 open reading frame 72
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Sequence: VRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPT
Interspecies mouse/rat: ENSMUSG00000022507: 97%, ENSRNOG00000002545: 97%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: C16orf72
Alternative Gene Name: FLJ41272, PRO0149
Sequence: VRSSTPGSPTHVSSGSNASRRRNGLHDVDLNTFISEEMALHLDNGGTRKRTSAQCGDVITDSPT
Interspecies mouse/rat: ENSMUSG00000022507: 97%, ENSRNOG00000002545: 97%
Entrez Gene ID: 29035
Uniprot ID: Q14CZ0
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen C16orf72 (ATL-APrEST92732) | |
| Antibody | Anti C16orf72 pAb (ATL-HPA067492) |
| Documents & Links for PrEST Antigen C16orf72 (ATL-APrEST92732) | |
| Datasheet | PrEST Antigen C16orf72 (ATL-APrEST92732) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C16orf72 (ATL-APrEST92732) at Atlas |
| Documents & Links for PrEST Antigen C16orf72 (ATL-APrEST92732) | |
| Datasheet | PrEST Antigen C16orf72 (ATL-APrEST92732) Datasheet (External Link) |
| Vendor Page | PrEST Antigen C16orf72 (ATL-APrEST92732) |