Protein Description: B-cell translocation gene 4
Gene Name: BTG4
Alternative Gene Name: PC3B
Sequence: GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: BTG4
Alternative Gene Name: PC3B
Sequence: GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE
Interspecies mouse/rat: ENSMUSG00000032056: 87%, ENSRNOG00000011277: 89%
Entrez Gene ID: 54766
Uniprot ID: Q9NY30
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen BTG4 (ATL-APrEST91787) | |
| Antibody | Anti BTG4 pAb (ATL-HPA057157) |
| Documents & Links for PrEST Antigen BTG4 (ATL-APrEST91787) | |
| Datasheet | PrEST Antigen BTG4 (ATL-APrEST91787) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTG4 (ATL-APrEST91787) at Atlas |
| Documents & Links for PrEST Antigen BTG4 (ATL-APrEST91787) | |
| Datasheet | PrEST Antigen BTG4 (ATL-APrEST91787) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BTG4 (ATL-APrEST91787) |