Protein Description: BOC cell adhesion associated, oncogene regulated
Gene Name: BOC
Alternative Gene Name: CDON2
Sequence: KHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLL
Interspecies mouse/rat: ENSMUSG00000022687: 74%, ENSRNOG00000002041: 74%
Entrez Gene ID: 91653
Uniprot ID: Q9BWV1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: BOC
Alternative Gene Name: CDON2
Sequence: KHTTDLGFPRSALPPSCPYTMVPLGGLPGHQASGQPYLSGISGRACANGIHMNRGCPSAAVGYPGMKPQQHCPGELQQQSDTSSLL
Interspecies mouse/rat: ENSMUSG00000022687: 74%, ENSRNOG00000002041: 74%
Entrez Gene ID: 91653
Uniprot ID: Q9BWV1
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen BOC (ATL-APrEST92105) | |
| Antibody | Anti BOC pAb (ATL-HPA060778) |
| Documents & Links for PrEST Antigen BOC (ATL-APrEST92105) | |
| Datasheet | PrEST Antigen BOC (ATL-APrEST92105) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BOC (ATL-APrEST92105) at Atlas |
| Documents & Links for PrEST Antigen BOC (ATL-APrEST92105) | |
| Datasheet | PrEST Antigen BOC (ATL-APrEST92105) Datasheet (External Link) |
| Vendor Page | PrEST Antigen BOC (ATL-APrEST92105) |