Protein Description: basal body orientation factor 1
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Sequence: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: BBOF1
Alternative Gene Name: C14orf45, CCDC176
Sequence: ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK
Interspecies mouse/rat: ENSMUSG00000057265: 81%, ENSRNOG00000011376: 81%
Entrez Gene ID: 80127
Uniprot ID: Q8ND07
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | ERAHHEAIVQLNDAGRNVFKENVYLQKALAYHLKETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALSYMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKK |
Gene ID - Mouse | ENSMUSG00000057265 |
Gene ID - Rat | ENSRNOG00000011376 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen BBOF1 (ATL-APrEST95284) | |
Datasheet | PrEST Antigen BBOF1 (ATL-APrEST95284) Datasheet (External Link) |
Vendor Page | PrEST Antigen BBOF1 (ATL-APrEST95284) at Atlas |
Documents & Links for PrEST Antigen BBOF1 (ATL-APrEST95284) | |
Datasheet | PrEST Antigen BBOF1 (ATL-APrEST95284) Datasheet (External Link) |
Vendor Page | PrEST Antigen BBOF1 (ATL-APrEST95284) |