PrEST Antigen BATF (ATL-APrEST88662)
Atlas Antibodies
- SKU:
- ATL-APrEST88662-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: BATF
Alternative Gene Name: B-ATF, BATF1, SFA-2
Sequence: TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV
Interspecies mouse/rat: ENSMUSG00000034266: 91%, ENSRNOG00000008588: 91%
Entrez Gene ID: 10538
Uniprot ID: Q16520
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | TEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHV |
Gene ID - Mouse | ENSMUSG00000034266 |
Gene ID - Rat | ENSRNOG00000008588 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen BATF (ATL-APrEST88662) | |
Datasheet | PrEST Antigen BATF (ATL-APrEST88662) Datasheet (External Link) |
Vendor Page | PrEST Antigen BATF (ATL-APrEST88662) at Atlas Antibodies |
Documents & Links for PrEST Antigen BATF (ATL-APrEST88662) | |
Datasheet | PrEST Antigen BATF (ATL-APrEST88662) Datasheet (External Link) |
Vendor Page | PrEST Antigen BATF (ATL-APrEST88662) |