Protein Description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Sequence: ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS
Interspecies mouse/rat: ENSMUSG00000069920: 91%, ENSRNOG00000053895: 91%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: B3GNT9
Alternative Gene Name: MGC4655
Sequence: ELVVVHGLSAADIWLMWRLLHGPHGPACAHPQPVAAGPFQWDS
Interspecies mouse/rat: ENSMUSG00000069920: 91%, ENSRNOG00000053895: 91%
Entrez Gene ID: 84752
Uniprot ID: Q6UX72
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen B3GNT9 (ATL-APrEST86016) | |
| Antibody | Anti B3GNT9 pAb (ATL-HPA052743) |
| Documents & Links for PrEST Antigen B3GNT9 (ATL-APrEST86016) | |
| Datasheet | PrEST Antigen B3GNT9 (ATL-APrEST86016) Datasheet (External Link) |
| Vendor Page | PrEST Antigen B3GNT9 (ATL-APrEST86016) at Atlas |
| Documents & Links for PrEST Antigen B3GNT9 (ATL-APrEST86016) | |
| Datasheet | PrEST Antigen B3GNT9 (ATL-APrEST86016) Datasheet (External Link) |
| Vendor Page | PrEST Antigen B3GNT9 (ATL-APrEST86016) |