Protein Description: beta-1,3-glucuronyltransferase 3
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Sequence: AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Sequence: AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen B3GAT3 (ATL-APrEST85590) | |
Antibody | Anti B3GAT3 pAb (ATL-HPA051328) |
Documents & Links for PrEST Antigen B3GAT3 (ATL-APrEST85590) | |
Datasheet | PrEST Antigen B3GAT3 (ATL-APrEST85590) Datasheet (External Link) |
Vendor Page | PrEST Antigen B3GAT3 (ATL-APrEST85590) at Atlas |
Documents & Links for PrEST Antigen B3GAT3 (ATL-APrEST85590) | |
Datasheet | PrEST Antigen B3GAT3 (ATL-APrEST85590) Datasheet (External Link) |
Vendor Page | PrEST Antigen B3GAT3 (ATL-APrEST85590) |