PrEST Antigen B3GAT3 (ATL-APrEST85590)
Atlas Antibodies
- SKU:
- ATL-APrEST85590-100
- Shipping:
- Calculated at Checkout
$345.00
Gene Name: B3GAT3
Alternative Gene Name: GlcAT-I
Sequence: AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY
Interspecies mouse/rat: ENSMUSG00000071649: 95%, ENSRNOG00000019804: 94%
Entrez Gene ID: 26229
Uniprot ID: O94766
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications | |
Gene Sequence | AASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVY |
Gene ID - Mouse | ENSMUSG00000071649 |
Gene ID - Rat | ENSRNOG00000019804 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links for PrEST Antigen B3GAT3 (ATL-APrEST85590) | |
Datasheet | PrEST Antigen B3GAT3 (ATL-APrEST85590) Datasheet (External Link) |
Vendor Page | PrEST Antigen B3GAT3 (ATL-APrEST85590) at Atlas Antibodies |
Documents & Links for PrEST Antigen B3GAT3 (ATL-APrEST85590) | |
Datasheet | PrEST Antigen B3GAT3 (ATL-APrEST85590) Datasheet (External Link) |
Vendor Page | PrEST Antigen B3GAT3 (ATL-APrEST85590) |