Protein Description: beta-1,3-glucuronyltransferase 1
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Sequence: LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI
Interspecies mouse/rat: ENSMUSG00000045994: 95%, ENSRNOG00000007142: 95%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: B3GAT1
Alternative Gene Name: CD57, GlcAT-P, HNK-1, LEU7, NK-1
Sequence: LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI
Interspecies mouse/rat: ENSMUSG00000045994: 95%, ENSRNOG00000007142: 95%
Entrez Gene ID: 27087
Uniprot ID: Q9P2W7
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen B3GAT1 (ATL-APrEST92864) | |
| Antibody | Anti B3GAT1 pAb (ATL-HPA069468) |
| Documents & Links for PrEST Antigen B3GAT1 (ATL-APrEST92864) | |
| Datasheet | PrEST Antigen B3GAT1 (ATL-APrEST92864) Datasheet (External Link) |
| Vendor Page | PrEST Antigen B3GAT1 (ATL-APrEST92864) at Atlas |
| Documents & Links for PrEST Antigen B3GAT1 (ATL-APrEST92864) | |
| Datasheet | PrEST Antigen B3GAT1 (ATL-APrEST92864) Datasheet (External Link) |
| Vendor Page | PrEST Antigen B3GAT1 (ATL-APrEST92864) |