Protein Description: N-acylsphingosine amidohydrolase (non-lysosomal ceramidase) 2
Gene Name: ASAH2
Alternative Gene Name:
Sequence: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Interspecies mouse/rat: ENSMUSG00000024887: 85%, ENSRNOG00000012196: 83%
Entrez Gene ID: 56624
Uniprot ID: Q9NR71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ASAH2
Alternative Gene Name:
Sequence: RTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQNHQT
Interspecies mouse/rat: ENSMUSG00000024887: 85%, ENSRNOG00000012196: 83%
Entrez Gene ID: 56624
Uniprot ID: Q9NR71
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ASAH2 (ATL-APrEST88313) | |
| Antibody | Anti ASAH2 pAb (ATL-HPA061171) |
| Documents & Links for PrEST Antigen ASAH2 (ATL-APrEST88313) | |
| Datasheet | PrEST Antigen ASAH2 (ATL-APrEST88313) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ASAH2 (ATL-APrEST88313) at Atlas |
| Documents & Links for PrEST Antigen ASAH2 (ATL-APrEST88313) | |
| Datasheet | PrEST Antigen ASAH2 (ATL-APrEST88313) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ASAH2 (ATL-APrEST88313) |