Protein Description: aftiphilin
Gene Name: AFTPH
Alternative Gene Name: FLJ20080, FLJ23793, MGC33965, Nbla10388
Sequence: DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
Interspecies mouse/rat: ENSMUSG00000049659: 79%, ENSRNOG00000005411: 84%
Entrez Gene ID: 54812
Uniprot ID: Q6ULP2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: AFTPH
Alternative Gene Name: FLJ20080, FLJ23793, MGC33965, Nbla10388
Sequence: DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
Interspecies mouse/rat: ENSMUSG00000049659: 79%, ENSRNOG00000005411: 84%
Entrez Gene ID: 54812
Uniprot ID: Q6ULP2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen AFTPH (ATL-APrEST87097) | |
| Antibody | Anti AFTPH pAb (ATL-HPA034990 w/enhanced validation) |
| Documents & Links for PrEST Antigen AFTPH (ATL-APrEST87097) | |
| Datasheet | PrEST Antigen AFTPH (ATL-APrEST87097) Datasheet (External Link) |
| Vendor Page | PrEST Antigen AFTPH (ATL-APrEST87097) at Atlas |
| Documents & Links for PrEST Antigen AFTPH (ATL-APrEST87097) | |
| Datasheet | PrEST Antigen AFTPH (ATL-APrEST87097) Datasheet (External Link) |
| Vendor Page | PrEST Antigen AFTPH (ATL-APrEST87097) |