Anti ZZZ3 pAb (ATL-HPA053663)

Atlas Antibodies

SKU:
ATL-HPA053663-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, ZZ-type containing 3
Gene Name: ZZZ3
Alternative Gene Name: ATAC1, DKFZP564I052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039068: 95%, ENSRNOG00000050321: 95%
Entrez Gene ID: 26009
Uniprot ID: Q8IYH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYLDPNYFPAN
Gene Sequence QMQAESGFVQHVGFKCDNCGIEPIQGVRWHCQDCPPEMSLDFCDSCSDCLHETDIHKEDHQLEPIYRSETFLDRDYCVSQGTSYNYLDPNYFPAN
Gene ID - Mouse ENSMUSG00000039068
Gene ID - Rat ENSRNOG00000050321
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZZZ3 pAb (ATL-HPA053663)
Datasheet Anti ZZZ3 pAb (ATL-HPA053663) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA053663) at Atlas Antibodies

Documents & Links for Anti ZZZ3 pAb (ATL-HPA053663)
Datasheet Anti ZZZ3 pAb (ATL-HPA053663) Datasheet (External Link)
Vendor Page Anti ZZZ3 pAb (ATL-HPA053663)