Protein Description: zyxin
Gene Name: ZYX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029860: 92%, ENSRNOG00000017354: 88%
Entrez Gene ID: 7791
Uniprot ID: Q15942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ZYX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029860: 92%, ENSRNOG00000017354: 88%
Entrez Gene ID: 7791
Uniprot ID: Q15942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF |
Documents & Links for Anti ZYX pAb (ATL-HPA073497) | |
Datasheet | Anti ZYX pAb (ATL-HPA073497) Datasheet (External Link) |
Vendor Page | Anti ZYX pAb (ATL-HPA073497) at Atlas |
Documents & Links for Anti ZYX pAb (ATL-HPA073497) | |
Datasheet | Anti ZYX pAb (ATL-HPA073497) Datasheet (External Link) |
Vendor Page | Anti ZYX pAb (ATL-HPA073497) |