Anti ZXDC pAb (ATL-HPA049593)

Atlas Antibodies

SKU: ATL-HPA049593-25

• 
• 

Protein Description: ZXD family zinc finger C
Gene Name: ZXDC
Alternative Gene Name: FLJ13861, MGC11349
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034430: 55%, ENSRNOG00000025818: 52%
Entrez Gene ID: 79364
Uniprot ID: Q2QGD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLP
• Gene Sequence: KIKEGKMSPPHFHASQNSWLCGSLVVPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLP
• Gene ID - Mouse: ENSMUSG00000034430
• Gene ID - Rat: ENSRNOG00000025818
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.