Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051253-25
  • Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum.
  • Western blot analysis using Anti-ZW10 antibody HPA051253 (A) shows similar pattern to independent antibody HPA055410 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zw10 kinetochore protein
Gene Name: ZW10
Alternative Gene Name: KNTC1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032264: 89%, ENSRNOG00000054479: 88%
Entrez Gene ID: 9183
Uniprot ID: O43264
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSE
Gene Sequence TSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSE
Gene ID - Mouse ENSMUSG00000032264
Gene ID - Rat ENSRNOG00000054479
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation)
Datasheet Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation)
Datasheet Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ZW10 pAb (ATL-HPA051253 w/enhanced validation)