Anti ZSWIM7 pAb (ATL-HPA054681)

Atlas Antibodies

SKU:
ATL-HPA054681-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, SWIM-type containing 7
Gene Name: ZSWIM7
Alternative Gene Name: SWS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014243: 75%, ENSRNOG00000002970: 86%
Entrez Gene ID: 125150
Uniprot ID: Q19AV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
Gene Sequence CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA
Gene ID - Mouse ENSMUSG00000014243
Gene ID - Rat ENSRNOG00000002970
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ZSWIM7 pAb (ATL-HPA054681)
Datasheet Anti ZSWIM7 pAb (ATL-HPA054681) Datasheet (External Link)
Vendor Page Anti ZSWIM7 pAb (ATL-HPA054681) at Atlas Antibodies

Documents & Links for Anti ZSWIM7 pAb (ATL-HPA054681)
Datasheet Anti ZSWIM7 pAb (ATL-HPA054681) Datasheet (External Link)
Vendor Page Anti ZSWIM7 pAb (ATL-HPA054681)