Anti ZSWIM1 pAb (ATL-HPA046751)

Atlas Antibodies

SKU: ATL-HPA046751-25

• 
• 

Protein Description: zinc finger, SWIM-type containing 1
Gene Name: ZSWIM1
Alternative Gene Name: C20orf162, dJ337O18.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017764: 72%, ENSRNOG00000015735: 71%
Entrez Gene ID: 90204
Uniprot ID: Q9BR11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPELHSHWLLNDRIWLAHRWRSRAESSHYFQSLEVTTHILSQFFGTTPSEKQGMASLFRYMQQNSADKANFNQGLCAQNNHAPSDTIPESPKLE
• Gene Sequence: LPELHSHWLLNDRIWLAHRWRSRAESSHYFQSLEVTTHILSQFFGTTPSEKQGMASLFRYMQQNSADKANFNQGLCAQNNHAPSDTIPESPKLE
• Gene ID - Mouse: ENSMUSG00000017764
• Gene ID - Rat: ENSRNOG00000015735
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.